PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.J02217.1.p
Common NameEUGRSUZ_J02217, LOC104422614
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 196aa    MW: 22411.1 Da    PI: 6.0305
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.J02217.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding57.14.1e-181966148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      +g+WT eEd++l+++++ +G g+W++ a+  g++Rt+k+c++rw++yl
  Eucgr.J02217.1.p 19 KGPWTMEEDLILINYIANHGEGSWNSLAKAAGLKRTGKSCRLRWLNYL 66
                      79********************************************97 PP

2Myb_DNA-binding54.42.8e-1772115146
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       rg+ TteE++l+ ++++++G++ W++Ia++++ gRt++++k++w++
  Eucgr.J02217.1.p  72 RGNITTEEQLLIMELHAKWGNR-WSKIAKHLP-GRTDNEIKNFWRT 115
                       7999******************.*********.***********96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.2E-241169IPR009057Homeodomain-like
PROSITE profilePS5129417.1691466IPR017930Myb domain
SuperFamilySSF466894.79E-3117113IPR009057Homeodomain-like
SMARTSM007171.6E-131868IPR001005SANT/Myb domain
PfamPF002494.0E-171966IPR001005SANT/Myb domain
CDDcd001672.00E-102166No hitNo description
PROSITE profilePS5129424.56967121IPR017930Myb domain
Gene3DG3DSA:1.10.10.605.0E-2470121IPR009057Homeodomain-like
SMARTSM007171.7E-1471119IPR001005SANT/Myb domain
PfamPF002498.7E-1672115IPR001005SANT/Myb domain
CDDcd001671.79E-1176115No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0080086Biological Processstamen filament development
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 196 aa     Download sequence    Send to blast
MDKKPDDDNG KSQDVEVRKG PWTMEEDLIL INYIANHGEG SWNSLAKAAG LKRTGKSCRL  60
RWLNYLRPDV RRGNITTEEQ LLIMELHAKW GNRWSKIAKH LPGRTDNEIK NFWRTRIQKH  120
IKQAEAFSGQ SSEMSDQAST SHMSSMPEPM ETYDSPPSFQ GNNNMEPLPV NLSVESNEAY  180
WSMDDLWSMQ LLNGD*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C6e-261612124128MYB TRANSFORMING PROTEIN
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.J02217.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010033288.11e-145PREDICTED: myb-related protein 305
SwissprotP813913e-91MYB05_ANTMA; Myb-related protein 305
TrEMBLA0A059AGE21e-145A0A059AGE2_EUCGR; Uncharacterized protein
STRINGGLYMA16G07960.15e-99(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM4282646
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G27810.12e-90myb domain protein 21